PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0157s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 551aa    MW: 60562.1 Da    PI: 7.1592
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0157s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-3296149255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtp+LH +Fv+ave+LGG+++AtPk +l+ m+vkgLt++hvkSHLQ+YR+
  Mapoly0157s0009.1.p  96 PRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQRMDVKGLTIAHVKSHLQMYRS 149
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-3192151IPR009057Homeodomain-like
PROSITE profilePS5129411.12692152IPR017930Myb domain
SuperFamilySSF466899.68E-1594152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2296150IPR006447Myb domain, plants
PfamPF002499.7E-997148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MLLQGEISSG SDEGPTWRDP SSRKRRSSSS GDTQTPDRSS ENTHNIGRPG GGGGGGGGGG  60
GGSSPSASPR GSPCLGFSGM GRSGGQVRQY VRSKMPRLRW TPDLHLCFVH AVERLGGQDR  120
ATPKLVLQRM DVKGLTIAHV KSHLQMYRSM KNDENGQATM PQTERKIPEG PDSSETFPRI  180
RLQHSDNGTV LIKDEATNTQ HYHNFLHRQV LQPLDHHASS RHDSLAWMGQ PEWIPRAYTA  240
NENATVAPGS QAHWAAEHEG HQIDYWNKKD QILHTASSQG PGADDRNKRQ SVSIEWDRKP  300
GSVDEYPPRL NLMSDGWSRV PAAEDAYQMN DRLRKSEMET EWGKWRMHEV RVDAANRGLQ  360
AGSLGHSAYS NISTPLFKAA APAPQTRVDT DSSKGLQHLD QSAWESDVQG RIALELQLQR  420
NLELKRMQEE KTEEKLRSAA AAGHDQLHQH GSMNMHWMSK LVETSMEKSS KRPPALQLAE  480
DPPDSTLSLS SLSQSYSTSS QSRPVRSASV VNIPDMNDVE GPPLQMSEEA TCIQPPQGIT  540
LDLTMSIGAG *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12126SRKRRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-32G2-like family protein